PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0067s0082.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Trihelix
Protein Properties Length: 321aa    MW: 35674.7 Da    PI: 4.7603
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0067s0082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix106.91.4e-3352136186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          rW+k evlaLi++r+++e+r++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf +l+
  Kaladp0067s0082.1.p  52 RWPKVEVLALIKLRSNLENRYQEAGPKGPLWEEISAGMQRMGYNRSSKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFYELD 136
                          8*********************************************************************8.99999******998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.39945109IPR017877Myb-like domain
SMARTSM007170.001249111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-450108IPR009057Homeodomain-like
CDDcd122037.69E-3151116No hitNo description
PfamPF138374.6E-2451138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MPIITLTLAV WIILEFYTIS IWNLIAIVIY HLQGDPASGG GGWSSSEAAS SRWPKVEVLA  60
LIKLRSNLEN RYQEAGPKGP LWEEISAGMQ RMGYNRSSKR CKEKWENINK YFKKVKESNK  120
KRPEDAKTCP YFYELDAIYQ RKILGGANTG SSSSSMVPFQ QQQPQQSLAL EGSTTTAKHQ  180
DTSVSNPGTV QTSATHAESI NKTDGTDLLV QPHNGGLPDD IFGDRGGHAR AGGGSTKPED  240
IMMELMKQQL VQQLLNLEDY EQQKMDELGD TTENVEEDQG EDEDESKEDR MAYEIDFQRP  300
PTNNKNGGNN GAPSFITMFQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518968.15e-71PREDICTED: trihelix transcription factor GTL1 isoform X1
RefseqXP_007039268.19e-71Duplicated homeodomain-like superfamily protein, putative isoform 1
SwissprotQ391175e-47TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLG8G9Q92e-72G8G9Q9_POPCN; GTL1
STRINGPOPTR_0001s45870.19e-56(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.16e-50Trihelix family protein